SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680987|ref|NP_935596.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680987|ref|NP_935596.1|
Domain Number 1 Region: 3-254
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.82e-108
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000282
Further Details:      
 
Domain Number 2 Region: 255-462
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 2.88e-60
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000076
Further Details:      
 
Domain Number 3 Region: 551-709
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.96e-52
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0089
Further Details:      
 
Domain Number 4 Region: 454-551
Classification Level Classification E-value
Superfamily Translation proteins 1.09e-18
Family AlaX-M N-terminal domain-like 0.026
Further Details:      
 
Weak hits

Sequence:  gi|37680987|ref|NP_935596.1|
Domain Number - Region: 701-797
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0246
Family Seryl-tRNA synthetase (SerRS) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37680987|ref|NP_935596.1|
Sequence length 860
Comment alanyl-tRNA synthetase [Vibrio vulnificus YJ016]
Sequence
MYMSTDEVRNAFLKFFESKGHQIVDSSSLVPHNDPTLLFTNAGMNQFKDCFLGAEKRAYT
RATTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFKEDAIAFAWEFLTETLK
LPKDRLLVTVYETDDEAFDIWNQKVGVPADRIIRIGDKKGGKQYESDNFWTMGDTGPCGP
CTEIFYDHGEHIWGGRPGTPEEDGDRFIEIWNNVFMQFNRHADGTMEPLPKPSVDTGMGI
ERISAIMQGVHSNYEIDVFQKLIKATAEIVGCEDLSNQSLRVIADHIRSCSFLIADGVMP
SNEGRGYVLRRIIRRAVRHGNKLGAQGVFFHKLVGVLAEVMGSAADELKKQQAVVEKVLR
IEEENFGRTLERGMVILNEALDALEGKELDGETVFKLYDTYGFPADLTNDVARERDFTID
EAGFEKAMEEQRQRAREAGQFGTDYNAKIKVDAQSEFCGYTSTQERSDVVALFVEGEETA
TLSAGDKAIVILQETPFYAESGGQCGDSGVLKTESGLFQVEDTQKLGNAIAHHGVLVEGV
LAKGDQVTAIVDAERRAAISLNHSATHLLHAALRQVLGEHVAQKGSLVKAENLRFDFSHL
EAVTAAELKEVERLVNAQIRRNHTIETNIMDIESAKQKGAMALFGEKYDDEVRVLSMGDF
STELCGGIHASNTGDIGLFKITSEGGIAAGIRRIEAVTGEAALEAIDAQARKFEEKLQDA
ANKAKSLEKEIQQLKDKLASQASANLIDQVKEIAGVKVLVAKLDGADNKALRGMVDELKN
QMGSGIIMLGNVADDKVGLIAGVTQDLTSKVKAGELVNMVAQQVGGKGGGRPDMAQAGGT
DSSALPSALASVDAWIAERL
Download sequence
Identical sequences A0A1L9L4D1 A0A1W6M6R9 Q7MHR6
gi|37680987|ref|NP_935596.1| 196600.VV2803 WP_011151142.1.16238 WP_011151142.1.28571 WP_011151142.1.30871 WP_011151142.1.34622 WP_011151142.1.47396 WP_011151142.1.53345 WP_011151142.1.59451 WP_011151142.1.60167 WP_011151142.1.93668 WP_011151142.1.94371 WP_011151142.1.9921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]