SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681023|ref|NP_935632.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681023|ref|NP_935632.1|
Domain Number 1 Region: 13-268,369-460
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.38e-78
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000000296
Further Details:      
 
Domain Number 2 Region: 251-366
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 6.13e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.000001
Further Details:      
 
Domain Number 3 Region: 439-538
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 3.53e-32
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37681023|ref|NP_935632.1|
Sequence length 548
Comment L-aspartate oxidase [Vibrio vulnificus YJ016]
Sequence
MNSFTLDRDFENFMNANREHECDVLVVGSGAAGLSLALRVANHCKVIVLSKGPRSEGATY
YAQGGIAAVFDESDSIESHVQDTLIAGDGICEEATVKFIAENAKECVQWLIDGGVPFDRE
EDDSDDKPRYHLTREGGHSHRRILHAADATGMAMQTSLQDNAHNHPNIHVLERHNALDLI
TEDKIGGDKNKVIGAYVWNRNQEHVETVKAKFVVLATGGASKVYQYTSNPDVSSGDGIAI
AWRAGCRVANMEFNQFHPTCLYHPEARNFLLTEALRGEGAYLRRPDGSRFMPDFDPREEL
APRDVVARAIDFEMKRLGADCMYLDISHKPAEFITKHFPMIHSRLMDLGIDMTKEPIPIV
PAAHYTCGGVMVDTNGQTDLHNLYAIGEVSYTGLHGANRMASNSLLECVVYAWAAAKDIL
KKHKQVDLASSLPSWDESQVTCSDEEVIIQHNWHELRLFMWDYMGIVRTDKRLERALRRI
QMLQQETHEYYSNFRVSNNLLELRNLLQVAELMVRCAMQRKESRGLHYTLDYPEQLENSG
PTILRPEE
Download sequence
Identical sequences Q7MHN0
196600.VV2839 gi|37681023|ref|NP_935632.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]