SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681091|ref|NP_935700.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681091|ref|NP_935700.1|
Domain Number 1 Region: 179-496
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.48e-126
Family Leucine aminopeptidase, C-terminal domain 0.000000000138
Further Details:      
 
Domain Number 2 Region: 1-184
Classification Level Classification E-value
Superfamily Macro domain-like 3.47e-52
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0000000925
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37681091|ref|NP_935700.1|
Sequence length 502
Comment leucyl aminopeptidase [Vibrio vulnificus YJ016]
Sequence
MEFSVKSGSPEKQRSACIVVGVFEPRRLSPVAEQLDKISDGYISSLLRRGDLEGKPGQML
LLHQVPGVLSERVLLVGCGKERELGERQYKEIIQKTINTLNETGSMEAVCFLTELHVKGR
DTYWKVRQAVEATKDGLYTFDQFKSVKPETRRPLRKLVFNVPTRRELNLGEKAITHGLAI
ASGVKACKDLGNMPPNIANPAYLASQARRLADDYETITTKIIGEQEMEKLGMSSYLAVGR
GSKNESMMSIIEYKGHPDSEAKPIVLVGKGLTFDSGGISLKPGEGMDEMKYDMCGAASVF
GTMKALAKLNLPVNVIGVLAGCENMPGSNAYRPGDILTTMSGQTVEVLNTDAEGRLVLCD
ALTYVERFEPDCVVDVATLTGACVIALGHHITGVLSNHNPLAHELVNASEQSSDRAWRLP
MADEYHEQLKSPFADMANIGGRPGGTITAACFLSKFAKKYNWAHLDIAGTAWKSGAAKGS
TGRPVSMLVQFLLNRSGQETEE
Download sequence
Identical sequences A0A087JK43 A0A0H0XUM7 A0A1L9KPN2 Q7MHG4 Q8DCE5
gi|27364860|ref|NP_760388.1| WP_011079433.1.100126 WP_011079433.1.13374 WP_011079433.1.16238 WP_011079433.1.17874 WP_011079433.1.21633 WP_011079433.1.22486 WP_011079433.1.22778 WP_011079433.1.24453 WP_011079433.1.25536 WP_011079433.1.28215 WP_011079433.1.28571 WP_011079433.1.30871 WP_011079433.1.31968 WP_011079433.1.33883 WP_011079433.1.34622 WP_011079433.1.39407 WP_011079433.1.39524 WP_011079433.1.43691 WP_011079433.1.47396 WP_011079433.1.49981 WP_011079433.1.512 WP_011079433.1.53782 WP_011079433.1.54486 WP_011079433.1.54603 WP_011079433.1.54858 WP_011079433.1.55006 WP_011079433.1.553 WP_011079433.1.58875 WP_011079433.1.58885 WP_011079433.1.59022 WP_011079433.1.59048 WP_011079433.1.59451 WP_011079433.1.60167 WP_011079433.1.60868 WP_011079433.1.61535 WP_011079433.1.63462 WP_011079433.1.63825 WP_011079433.1.65015 WP_011079433.1.66219 WP_011079433.1.66581 WP_011079433.1.67868 WP_011079433.1.73066 WP_011079433.1.73173 WP_011079433.1.78369 WP_011079433.1.78668 WP_011079433.1.79678 WP_011079433.1.81060 WP_011079433.1.81460 WP_011079433.1.81555 WP_011079433.1.82587 WP_011079433.1.8292 WP_011079433.1.8379 WP_011079433.1.84562 WP_011079433.1.86005 WP_011079433.1.86748 WP_011079433.1.89979 WP_011079433.1.90288 WP_011079433.1.93668 WP_011079433.1.94371 WP_011079433.1.95941 WP_011079433.1.96968 WP_011079433.1.9921 WP_011079433.1.99976 196600.VV2907 216895.VV1_1476 gi|320155251|ref|YP_004187630.1| gi|37681091|ref|NP_935700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]