SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681094|ref|NP_935703.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681094|ref|NP_935703.1|
Domain Number 1 Region: 1-192,364-571,609-641
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.35e-135
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000687
Further Details:      
 
Domain Number 2 Region: 642-898
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.8e-67
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.000081
Further Details:      
 
Domain Number 3 Region: 191-365
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.44e-58
Family ValRS/IleRS/LeuRS editing domain 0.0000463
Further Details:      
 
Domain Number 4 Region: 884-948
Classification Level Classification E-value
Superfamily tRNA-binding arm 6.8e-19
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37681094|ref|NP_935703.1|
Sequence length 951
Comment valyl-tRNA synthetase [Vibrio vulnificus YJ016]
Sequence
MEKTYNPTSIEQDLYKTWEEQGYFKPHGDTSKESYSIMIPPPNVTGSLHMGHAFQDTIMD
TLIRCERMKGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTKHDYGREAFIDKIWEWKGE
SGGTITKQLRRLGASVDWDRERFTMDDGLSNAVQEVFVRLYEDDLIYRGKRLVNWDPKLH
TAISDLEVENKDTKGHMWHFRYPLADGVKTADGKDYIVVATTRPETMLGDTGVAVNPEDP
RYQDLIGKDIILPIVDRRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHQLPMINI
LTFDANIRDAAEVFTTNGEPSDAYGTELPAKYHGMERFAARKAIVAEFDELGLLEEVKDH
DLQVPYGDRGGVVIEPMLTDQWYVRTAPLAKTAVEAVENGDIQFVPKQYENMYFSWMRDV
QDWCISRQLWWGHRIPAWYDNQGNVYVGRSEEEVRQNHNLESVIELHQDEDVLDTWFSSA
LWTFGTQGWPEQTDDLKVFHPSDVLVTGFDIIFFWVARMIMMTMHFVKDENGKPQVPFKT
VYVTGLIRDENGDKMSKSKGNVLDPIDMIDGIDLESLVEKRTGNMMQPQLAAKIEKNTRK
TFENGIEAYGTDALRFTLAAMASTGRDINWDMKRLEGYRNFCNKLWNASRYVMMNTEEQD
CGFGAGEIEYSLADKWIESQFELAAKAFNNHIDNYRLDMAANTLYEFIWNQFCDWYLELT
KPVLWKGTEAQQRGTRRTLITVLEKTLRLAHPVIPYITETIWQSIKPLVDGVEGETIMLQ
SLPQYDEANFNQEALDDIEWVKAFITSIRNLRAEYDINPGKPLEVMLKADEKDAARLEAN
KQVLMSLAKLESVRVLAAGEETPACATALVAKSELMIPMAGLIDKDAELARLDKEVAKTQ
GEIKRIEGKLGNEGFVAKAPEAVIAKEREKLEGYQETLAKLEEQKATIAAL
Download sequence
Identical sequences A0A0H0XSV0 A0A1W6M715 Q7MHG1 Q8DCE7
196600.VV2910 216895.VV1_1474 WP_011079431.1.16238 WP_011079431.1.17874 WP_011079431.1.21633 WP_011079431.1.22778 WP_011079431.1.25536 WP_011079431.1.34622 WP_011079431.1.66581 WP_011079431.1.73066 WP_011079431.1.79678 WP_011079431.1.81460 WP_011079431.1.90288 WP_011079431.1.93668 gi|37681094|ref|NP_935703.1| gi|27364858|ref|NP_760386.1| gi|320155249|ref|YP_004187628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]