SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681150|ref|NP_935759.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681150|ref|NP_935759.1|
Domain Number 1 Region: 154-350
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-57
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000247
Further Details:      
 
Domain Number 2 Region: 435-567
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-33
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000001
Further Details:      
 
Domain Number 3 Region: 17-150
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.08e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.00023
Further Details:      
 
Domain Number 4 Region: 352-428
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.8e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37681150|ref|NP_935759.1|
Sequence length 578
Comment sulfite reductase subunit beta [Vibrio vulnificus YJ016]
Sequence
MTFSIENNKQVVLGEELGKLSDNERLKTQSNFLRGTIEQDLQDRITGGFTADNFQLIRFH
GMYQQDDRDIRNERAKQKLEPLHNVMLRARMPGGIITPKQWLAIDKFATEHSLYGSIRLT
TRQTFQFHGVLKPNIKLMHQTLNSIGIDSIATAGDVNRNVLCTTNPVESELHQEAYEWAK
KISEHLLPKTKAYAEIWLDGEKVETTEDDEPILGKTYLPRKFKTTVVIPPQNDVDVHAND
LNFVAIAENGKLIGFNVLVGGGLAMTHGDTSTYPRRADDFGYIPLEKTLDVAAAVVTTQR
DWGNRSNRKNAKTKYTLDRVGTDVFKAEVEKRAGIKFEVSRPYEFTERGDRIGWVEGIDG
KHHLTLFIENGRLLDYPGKPLKTGVAEIAKIHKGDFRMTANQNLIVAGVSKSNKAKIEKL
AREHGLMDEGVSEQRKNSMACVAFPTCPLAMAEAERFLPQFVTDVEGILDKHGLDKEDNI
ILRVTGCPNGCGRAMLAEIGLVGKAPGRYNLHLGGNRGGTRVPKMYKENITEKQILEEID
QLVGRWANERLPNECFGDFTVRVGIIEEVIISKRDFYA
Download sequence
Identical sequences Q7MHA6
gi|37681150|ref|NP_935759.1| WP_011151263.1.34622 WP_011151263.1.54486 WP_011151263.1.58885 WP_011151263.1.99976 196600.VV2966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]