SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681187|ref|NP_935796.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681187|ref|NP_935796.1|
Domain Number 1 Region: 3-176,301-377
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.14e-55
Family Bacterial dinuclear zinc exopeptidases 0.0011
Further Details:      
 
Domain Number 2 Region: 177-291
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.64e-22
Family Bacterial exopeptidase dimerisation domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37681187|ref|NP_935796.1|
Sequence length 378
Comment acetylornithine deacetylase [Vibrio vulnificus YJ016]
Sequence
MQLPSFLDVYRGLISTSSISSSDPSWDQGNQAVIEKLSDWFSALGFDVDVTEVEPGKYNL
LAQKGQGEGGLLLAGHSDTVPFDQGRWSFDPHQLTEKDNKFYGLGTADMKGFFAFIYEAA
KRMDWKGQNKPLYVLATCDEETTMLGARHFSAHTPFKPDYCIIGEPTSLVPVRGHKGHVA
NVVRVTGKSGHSSDPSLGVNAIEIMHEVLFALMQLRDTLIKQYHNPGFAIPSPTLNLGHI
HGGDSANRICGCCELHYDVRPLPGISLDGLDNLLRGALKEVEAKWPGRIEIVPLHEPIPG
YECQHDHPFIHGIEDLCGTPSQTVNYCTEAPFLQQLCPTLVLGPGSIDQAHQPDEFLAFD
FIDPTIDVLSKAMRKYCF
Download sequence
Identical sequences Q7MH69
196600.VV3003 gi|37681187|ref|NP_935796.1| WP_011151287.1.100126 WP_011151287.1.34622 WP_011151287.1.54858 WP_011151287.1.59022 WP_011151287.1.78369 WP_011151287.1.8292 WP_011151287.1.89979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]