SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681213|ref|NP_935822.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681213|ref|NP_935822.1|
Domain Number 1 Region: 6-219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.71e-60
Family G proteins 0.0000000295
Further Details:      
 
Domain Number 2 Region: 298-393
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.17e-35
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000316
Further Details:      
 
Domain Number 3 Region: 205-301
Classification Level Classification E-value
Superfamily Translation proteins 5.3e-30
Family Elongation factors 0.00000712
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37681213|ref|NP_935822.1|
Sequence length 394
Comment elongation factor Tu [Vibrio vulnificus YJ016]
Sequence
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAICTVLSKVYGGTARDFASIDNAPEERERG
ITISTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFPGDDLPVIQGSALGALN
GEEQWEAKIVELAEALDSYIPEPERAVDMPFLMPIEDVFSIQGRGTVVTGRIERGILKVG
DEVAIVGIKDTTTTTCTGVEMFRKLLDEGRAGENVGALLRGTKRDEVERGQVLAKPGSIT
PHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDISLPEGVEMVMPGDNIQMV
VELISPIAMDEGLRFAIREGGRTVGAGVVAKIFA
Download sequence
Identical sequences Q7MH43
WP_011151305.1.34622 196600.VV3029 gi|37681213|ref|NP_935822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]