SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681214|ref|NP_935823.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681214|ref|NP_935823.1|
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.97e-107
Family G proteins 0.0000000325
Further Details:      
 
Domain Number 2 Region: 484-604
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-47
Family Translational machinery components 0.00000608
Further Details:      
 
Domain Number 3 Region: 271-409
Classification Level Classification E-value
Superfamily Translation proteins 5.08e-36
Family Elongation factors 0.0000726
Further Details:      
 
Domain Number 4 Region: 608-695
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.71e-30
Family EF-G/eEF-2 domains III and V 0.0001
Further Details:      
 
Domain Number 5 Region: 407-485
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.99e-25
Family EF-G/eEF-2 domains III and V 0.0000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37681214|ref|NP_935823.1|
Sequence length 699
Comment elongation factor G [Vibrio vulnificus YJ016]
Sequence
MARKTPIERYRNIGICAHVDAGKTTTTERILFYTGLSHKIGEVHDGAATMDWMEQEQERG
ITITSAATTTFWRGMEAQFQDHRVNIIDTPGHVDFTIEVERSLRVLDGAVVVFCGSSGVE
PQSETVWRQADKYHVPRMVFVNKMDRAGADFLRVVDQIKNRLGANPVPIQLNVGAEEDFK
GVIDLIKMKMINWNEADQGMTFTYEEIPADMIELAEEWRNNLVEAAAEASEELMDKYLEE
GELTEAEIKQALRARTLNNEIVLATCGSAFKNKGVQAVLDAVIEYLPSPIDVPAIKGIDE
NDNEVERHADDNEPFSALAFKIATDPFVGTLTFIRVYSGVVNTGDAVYNSVKQKKERFGR
IVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTLCNSDHKVILERMEFPEPVIQIAVEP
RSKADQEKMGIALGKLAAEDPSFRVETDAETGQTLISGMGELHLDIIVDRMKREFSVDCN
VGKPQVAYRETIRGKSEVEGKFVRQSGGRGQYGHVWIKLEPSEPGAGFVFVDEVVGGVIP
KEYISSVAKGIEEQMNSGVLAGYPVLDIKATLFDGSYHDVDSSEMAFKIAGSMAFKKGAL
EAQPVILEPMMKVEVTTPEDWMGDVVGDLNRRRGIIEGMDEGVAGLKIIRAQVPLSEMFG
YATDLRSATQGRASYSMEFFEYAEVPKNIAEAIVAERGY
Download sequence
Identical sequences A0A1L9KTP9 Q7MH42 Q8DCQ8
gi|27364737|ref|NP_760265.1| WP_011079317.1.100126 WP_011079317.1.17874 WP_011079317.1.21633 WP_011079317.1.22778 WP_011079317.1.33883 WP_011079317.1.34622 WP_011079317.1.53345 WP_011079317.1.54858 WP_011079317.1.55006 WP_011079317.1.58885 WP_011079317.1.59022 WP_011079317.1.78369 WP_011079317.1.8292 WP_011079317.1.89979 WP_011079317.1.90288 WP_011079317.1.94371 gi|37681214|ref|NP_935823.1| 196600.VV3030 216895.VV1_1338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]