SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681242|ref|NP_935851.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681242|ref|NP_935851.1|
Domain Number 1 Region: 5-334
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.25e-92
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37681242|ref|NP_935851.1|
Sequence length 338
Comment tryptophanyl-tRNA synthetase [Vibrio vulnificus YJ016]
Sequence
MSKPIVLSGVQPSGELSIGNYLGALRQWQQMQDDYDCQYCVVDLHAITVRQDPKALHEAT
LDALAICLAVGVDPKKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFKDKSARYAND
VNVGLFGYPVLMAADILLYGAHQVPVGSDQKQHLELARDIATRFNNIYSPENPIFTIPEP
YIPTVNARVMSLQDATKKMSKSDDNRKNVITLLEDPKSIIKKINKAQTDTETPPRIAHDW
DNKAGISNLMGLYSAATGMSFEEIEAKYQGVEMYGPFKKDVGEALVAMLEPIQAEYHRIR
EDRGYMNEVMRQGADKASARAAETLKKVYEVVGFVGRP
Download sequence
Identical sequences A0A087IYA7 Q7MH15
WP_011151320.1.100126 WP_011151320.1.24453 WP_011151320.1.28215 WP_011151320.1.28571 WP_011151320.1.30871 WP_011151320.1.31968 WP_011151320.1.34622 WP_011151320.1.39524 WP_011151320.1.47396 WP_011151320.1.49981 WP_011151320.1.53782 WP_011151320.1.54603 WP_011151320.1.54858 WP_011151320.1.553 WP_011151320.1.59022 WP_011151320.1.59048 WP_011151320.1.59451 WP_011151320.1.60167 WP_011151320.1.60868 WP_011151320.1.61535 WP_011151320.1.63825 WP_011151320.1.66219 WP_011151320.1.67868 WP_011151320.1.78369 WP_011151320.1.78668 WP_011151320.1.81060 WP_011151320.1.81555 WP_011151320.1.82587 WP_011151320.1.8292 WP_011151320.1.84562 WP_011151320.1.86005 WP_011151320.1.89979 WP_011151320.1.95941 196600.VV3058 gi|37681242|ref|NP_935851.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]