SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681257|ref|NP_935866.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681257|ref|NP_935866.1|
Domain Number 1 Region: 1-204
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.68e-53
Family DNA gyrase/MutL, N-terminal domain 0.0000000527
Further Details:      
 
Domain Number 2 Region: 479-662
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 1.96e-37
Family DNA mismatch repair protein MutL 0.00011
Further Details:      
 
Domain Number 3 Region: 191-330
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.34e-37
Family DNA gyrase/MutL, second domain 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37681257|ref|NP_935866.1|
Sequence length 664
Comment DNA mismatch repair protein [Vibrio vulnificus YJ016]
Sequence
MTIRILPARLANQIAAGEVVERPASVVKELVENSLDSGATKIDIDIEKGGAKLIRIRDNG
SGIVKDELGLALSRHATSKIHTLDDLEAIMSLGFRGEALASISSVSRLTLTSRPATQEQA
WSAYTEGRDMQVKLQPTAHPIGTTVEVVDLFFNTPARRKFLRTEKTEFAHIDELLKRIAL
SRFDVSITLRHNGKVIRQYRAAHNDLQAEKRLATVCGQAFVRCMLKIELEHQGLKLHGWI
TTPEGARQQSDLQYCYVNGRMMRDKLINHAIRQSYETSLKPEQFAAYVLFIELDPHQVDV
NVHPAKHEVRFHQARLVHDFIYQALASALAQSDSIEQPQINESAFHYQAEPEVAPLGSFP
AESNEVPQAVYHAIEKAPAYPRKAGQEQQLQPVAPLESSFSSEQGREVAPAPHNERNAWM
ESRSPARHTTSSNQSERYGEPAPSKQQVKAYAELLHTPDFPSQNVECHPSPSIASPVQEL
GKAVSVVAQRYLLTTTKAGCQLISLARAEFYRILGQLNGDKAPLKSQPLLVPLSLKLEKG
LVHAAQEHQDRFARMGILFKMRNEKALMVMGVPAPLRQQNLQLLIPDLLSYAASQAQKEE
QAKNDTAMAQWLALRVAKVKSHYTLSEAIQIISELEQLWQEKLPLQDAQLVTSVDFSATI
AQLT
Download sequence
Identical sequences Q7MH01
196600.VV3073 WP_011151329.1.34622 gi|37681257|ref|NP_935866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]