SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681258|ref|NP_935867.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681258|ref|NP_935867.1|
Domain Number 1 Region: 168-264,315-391
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.79e-52
Family N-acetylmuramoyl-L-alanine amidase-like 0.00052
Further Details:      
 
Domain Number 2 Region: 527-570
Classification Level Classification E-value
Superfamily LysM domain 0.000000000196
Family LysM domain 0.0039
Further Details:      
 
Domain Number 3 Region: 408-452
Classification Level Classification E-value
Superfamily LysM domain 0.000000000549
Family LysM domain 0.0038
Further Details:      
 
Domain Number 4 Region: 472-518
Classification Level Classification E-value
Superfamily LysM domain 0.00000000562
Family LysM domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37681258|ref|NP_935867.1|
Sequence length 572
Comment N-acetylmuramoyl-L-alanine amidase [Vibrio vulnificus YJ016]
Sequence
MLSLKRIQKAAVWLSALYFLIPSLVWANVLQGVRVWPSPDETRVVVDLADEANFSYFSLT
KPDRLVVDLKSTSLKTKLPITVSDSPVLSRIRQSSPPEQGTYRLVFELKKSAPAELFKLA
PTPGGDYGHRLVIDLPHKARSTTTSSNNNAKPQTVNKDIQSVQRAEEILIVIDPGHGGED
PGSIGPTRRYEKNATLSISHKIAAELDAVPGIKTKLTRSGDYFVNLNRRVAIARENDAHL
LISVHADAFTSPQPRGGSVFVLNTRRANTEIARWVENHEKQSEILGGSGAAFTNINDKNV
NQTLLDLQFSHSQKEGYKLATEILSEMGKVAQLHNSQPINTSLAVLRSPQIPSVLVETGF
ISNPTEEKLLFQRAHQDKLAKAISKAVLKYLKDNPPEGTVFASSAKPIVHTVKRGESLSV
IAERYGTSTQTIMKDNQLKSSTLSIGQTLKIHRGVPGPKVIAAQPNTVETKTITHKVSKG
EFLGMIADRYKVSVADIRRENKLKSDTLWVGQKLSITVNLKDQPIRKHTVARGEFLSKIA
AKYGVSVSSIRQANNLRSDELAIGQVLIIPNK
Download sequence
Identical sequences A0A0H0XTX7 A0A1W6M7J4 Q7MH00
WP_011079273.1.16238 WP_011079273.1.17874 WP_011079273.1.21633 WP_011079273.1.22486 WP_011079273.1.22778 WP_011079273.1.25536 WP_011079273.1.34622 WP_011079273.1.53345 WP_011079273.1.55006 WP_011079273.1.66581 WP_011079273.1.73066 WP_011079273.1.79678 WP_011079273.1.81460 WP_011079273.1.8379 WP_011079273.1.90288 WP_011079273.1.93668 WP_011079273.1.94371 gi|37681258|ref|NP_935867.1| gi|320155084|ref|YP_004187463.1| gi|27364691|ref|NP_760219.1| 196600.VV3074 216895.VV1_1291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]