SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681271|ref|NP_935880.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681271|ref|NP_935880.1|
Domain Number 1 Region: 191-343
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 6.89e-56
Family Glycerol-3-phosphate dehydrogenase 0.0000626
Further Details:      
 
Domain Number 2 Region: 15-190
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.38e-49
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37681271|ref|NP_935880.1|
Sequence length 345
Comment NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MTQTLVNNAYGKEISMTVIGAGSYGTSLAISLSRNGANVVLWGHEPEHMAKLEADRANHE
FLPGIEFPPSLIVESDLAKAVQASRDLLVVVPSHVFGIVLNSLKPYLRDDSRICWATKGL
EPETGRLLKDVAFDVLGEHYSLAVLSGPTFAKELAAGMPTAISVASPDAQFVADLQEKIH
CSKTFRVYANSDFTGMQLGGAVKNVIAIGAGMSDGIGFGANARTALITRGLAEMCRLGAA
LGAQPETFMGMAGLGDLVLTCTDNQSRNRRFGLALGQGKDVDTAQADIGQVVEGYRNTKE
VWMLAQRMGVEMPIVDQIYQVLYQGKDARLAAQDLLARDKKSEGK
Download sequence
Identical sequences A0A0H0Y6C3 A0A1L9KTJ6 A0A1W6M7K9 Q7MGY7 Q8DCW4
gi|27364678|ref|NP_760206.1| gi|320155072|ref|YP_004187451.1| WP_011079262.1.16238 WP_011079262.1.17874 WP_011079262.1.21633 WP_011079262.1.22778 WP_011079262.1.24453 WP_011079262.1.25536 WP_011079262.1.28215 WP_011079262.1.28571 WP_011079262.1.30871 WP_011079262.1.31968 WP_011079262.1.34622 WP_011079262.1.47396 WP_011079262.1.512 WP_011079262.1.53345 WP_011079262.1.55006 WP_011079262.1.58875 WP_011079262.1.58885 WP_011079262.1.59451 WP_011079262.1.60167 WP_011079262.1.60868 WP_011079262.1.61535 WP_011079262.1.66219 WP_011079262.1.66581 WP_011079262.1.73066 WP_011079262.1.79678 WP_011079262.1.81460 WP_011079262.1.81555 WP_011079262.1.8379 WP_011079262.1.90288 WP_011079262.1.93668 WP_011079262.1.94371 WP_011079262.1.96968 WP_011079262.1.9921 196600.VV3087 216895.VV1_1277 gi|37681271|ref|NP_935880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]