SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681290|ref|NP_935899.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681290|ref|NP_935899.1|
Domain Number 1 Region: 185-376
Classification Level Classification E-value
Superfamily GroEL apical domain-like 4.49e-84
Family GroEL-like chaperone, apical domain 0.000000072
Further Details:      
 
Domain Number 2 Region: 3-230
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.02e-67
Family GroEL chaperone, ATPase domain 0.00000657
Further Details:      
 
Domain Number 3 Region: 373-525
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 2.44e-31
Family GroEL chaperone, ATPase domain 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37681290|ref|NP_935899.1|
Sequence length 546
Comment chaperonin GroEL [Vibrio vulnificus YJ016]
Sequence
MAAKDVKFGNDARVKMLEGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
ELEDKFQNMGAQMVKQVASQANDVAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
DKAVAAAVEELKALSKDCSTSTEIEQVGTISANSDSSVGKIIAEAMEKVGRDGVITVEEG
QALHDELDVVEGMQFDRGYLSPYFINNQESGSVELESPFILLVDKKISNIRELLPALEAV
AKASRPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV
ISEEVGLELEKATLEDLGQAKRVSITKENTTIIDGVGEEAMIQGRVAQIRQQIEDATSDY
DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGIVAGGGVALI
RAASKIVDLQGDNEEQNVGIRVALRAMEAPLRQITKNAGDEESVVANNVRAGEGSYGYNA
ATGVYGDMLEMGILDPTKVTRSALQFAASVAGLMITTEAMVTDLPQKDSGMPDMGGMGGM
GGMGMM
Download sequence
Identical sequences A0A087JWR6 A0A0H0Y4I2 Q7M7I7 Q9ALA9
gi|37681290|ref|NP_935899.1| gi|27364661|ref|NP_760189.1| WP_011079245.1.100126 WP_011079245.1.16238 WP_011079245.1.17874 WP_011079245.1.21633 WP_011079245.1.22486 WP_011079245.1.22778 WP_011079245.1.25536 WP_011079245.1.28215 WP_011079245.1.28571 WP_011079245.1.30871 WP_011079245.1.31968 WP_011079245.1.33883 WP_011079245.1.34622 WP_011079245.1.39407 WP_011079245.1.39524 WP_011079245.1.43691 WP_011079245.1.47396 WP_011079245.1.49981 WP_011079245.1.512 WP_011079245.1.54486 WP_011079245.1.54858 WP_011079245.1.55006 WP_011079245.1.58875 WP_011079245.1.58885 WP_011079245.1.59022 WP_011079245.1.59451 WP_011079245.1.60167 WP_011079245.1.60868 WP_011079245.1.63462 WP_011079245.1.63825 WP_011079245.1.66219 WP_011079245.1.66581 WP_011079245.1.73066 WP_011079245.1.73173 WP_011079245.1.78369 WP_011079245.1.78668 WP_011079245.1.79678 WP_011079245.1.81060 WP_011079245.1.81460 WP_011079245.1.81555 WP_011079245.1.82587 WP_011079245.1.8292 WP_011079245.1.84562 WP_011079245.1.86005 WP_011079245.1.89979 WP_011079245.1.90288 WP_011079245.1.93668 WP_011079245.1.95941 WP_011079245.1.96968 WP_011079245.1.9921 WP_011079245.1.99976 gi|320155056|ref|YP_004187435.1| 196600.VV3106 216895.VV1_1260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]