SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681298|ref|NP_935907.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681298|ref|NP_935907.1|
Domain Number 1 Region: 296-458
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-35
Family Histidine kinase 0.0013
Further Details:      
 
Domain Number 2 Region: 230-305
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000196
Family Homodimeric domain of signal transducing histidine kinase 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|37681298|ref|NP_935907.1|
Domain Number - Region: 191-242
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000314
Family HAMP domain 0.012
Further Details:      
 
Domain Number - Region: 87-143
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 0.0523
Family Nucleoside diphosphate kinase, NDK 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37681298|ref|NP_935907.1|
Sequence length 462
Comment two-component sensor protein [Vibrio vulnificus YJ016]
Sequence
MRLPKITSLYGRIFAIFWFTMFLVLMAVLALPHLDPRKARNIPADQYDRFIEAKQEIEKQ
YRGETDLGRILFRMERPGDRHGRDGRPRFFITDYDGNILTTLKQGDFQLKALKNFVTSIE
QPDQPKQKLYGRFMLSGPLPVTLANKEYLLYVGMRWNQPPPFLLRMFDHPFQLLLAVMLV
STPLLLWLAWALSQPARRLEKAAQRVAKGEFVTDPSLEKGTSEFRQAGASFNRMVEAVNQ
MISGQQRLLSDISHELRSPLTRLRMANALATRKQGESNELQRIDTEAQRLEQMISELLEL
SRMQMNSHLDREEQPVASLWEEIIQDAQFEAEQMGKVLQYTPLPERHISGNPKLLMSAIE
NIIRNAIYYGKDQVIIAIQAIDDTLHIVVDDNGEGVPEEELEAIFRPFYRVSTARDRHSG
GTGLGLSITESAIRQHSGTIKAERSDLGGLRVTITLPLVKRR
Download sequence
Identical sequences A0A0H0Y5R9 A0A1L9KTM5 Q7MGW2
gi|37681298|ref|NP_935907.1| 196600.VV3114 WP_011151353.1.16238 WP_011151353.1.22778 WP_011151353.1.34622 WP_011151353.1.53345 WP_011151353.1.55006 WP_011151353.1.66581 WP_011151353.1.79678 WP_011151353.1.90288 WP_011151353.1.94371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]