SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681330|ref|NP_935939.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681330|ref|NP_935939.1|
Domain Number 1 Region: 181-315
Classification Level Classification E-value
Superfamily CBS-domain pair 8.1e-25
Family CBS-domain pair 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37681330|ref|NP_935939.1|
Sequence length 362
Comment hemolysin [Vibrio vulnificus YJ016]
Sequence
MLLLTIYISIAIGVSFICSVLEAVLLSISPSYIAQLRQQGHPAAAQLTKLKADIDRPLAS
ILTLNTIAHTIGAATAGAQAAVVFGSEWLGVFSGVLTLGILVLSEIVPKTIGATYWRQLA
PSAASTLRWMVWALTPFVWFSEQITKRLARNQETPKMRDELSAMAILARESGEFAEGESK
ILSNLLGIQDVPVTQVMTPRPVVFRVEATMTINEFLAQHKETPFSRPLVYSEQKDNIIGF
VHRLELFKLQQSGAGEKQLGSVMRPIHVIMNTLALPKAFDQMMAKRLQLSIVVDEYGTVL
GLVTLEDIFEYLLGEEIIDEADKSQDMQELAYQRWERWKNKHGMIESRDDDEDEGSNDKT
KS
Download sequence
Identical sequences A0A1V8MUS2 Q7MGT1
gi|27364626|ref|NP_760154.1| gi|37681330|ref|NP_935939.1| WP_011079211.1.100126 WP_011079211.1.16238 WP_011079211.1.17874 WP_011079211.1.22486 WP_011079211.1.34622 WP_011079211.1.39407 WP_011079211.1.39524 WP_011079211.1.54486 WP_011079211.1.54858 WP_011079211.1.59022 WP_011079211.1.73173 WP_011079211.1.78369 WP_011079211.1.81460 WP_011079211.1.82587 WP_011079211.1.8292 WP_011079211.1.89979 WP_011079211.1.9921 WP_011079211.1.99976 196600.VV3146 216895.VV1_1223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]