SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681399|ref|NP_936008.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681399|ref|NP_936008.1|
Domain Number 1 Region: 106-273
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.08e-41
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000217
Further Details:      
 
Domain Number 2 Region: 6-105
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 8.63e-32
Family Shikimate dehydrogenase-like 0.0000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37681399|ref|NP_936008.1|
Sequence length 277
Comment shikimate 5-dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MTQQIDRYAVFGNPIEHSKSPFIHTLFARQTNQPLIYTAETAPKEGFVEAVKAFFAEGGK
GCNVTLPFKEEAYQFASRLTERAQLAGAVNTLKKLDDGDIIGDNTDGAGLVQDLLQHQVV
LAGARILVIGAGGAARGVLKPLLDQKPTSLTITNRTFSKAEELAVLFAAYGSVTAKEMNT
VTEEYDVIINSTSASLSGELPALSSSIFAANSTSYDMMYGKGDTTFNQWAKQHGAAHAYD
GLGMLVGQAAESFMLWRGLRPGSKQILRELRKNLEGL
Download sequence
Identical sequences A0A1L9KPZ4 Q7MGL5
WP_011151416.1.34622 WP_011151416.1.53345 WP_011151416.1.55006 WP_011151416.1.81460 WP_011151416.1.90288 WP_011151416.1.94371 WP_011151416.1.9921 196600.VV3215 gi|37681399|ref|NP_936008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]