SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681434|ref|NP_936043.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681434|ref|NP_936043.1|
Domain Number 1 Region: 5-87
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase N-terminal domain 2.62e-24
Family Epsilon subunit of F1F0-ATP synthase N-terminal domain 0.0000167
Further Details:      
 
Domain Number 2 Region: 89-138
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase C-terminal domain 0.000000000000228
Family Epsilon subunit of F1F0-ATP synthase C-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37681434|ref|NP_936043.1|
Sequence length 140
Comment F0F1 ATP synthase subunit epsilon [Vibrio vulnificus YJ016]
Sequence
MAAITFHLDVVSAEKKIFSGRVETFQVTGSEGELGIFHGHTPLLTAIKPGMVRIVKLHGE
EEFIYVSGGIVEVQPGTATVLADTAIRGEELDAAKAEEAKRRAKENILNQHGDMDFAQAA
SELAKAIAQLRVIELTKKRR
Download sequence
Identical sequences A0A087I341 A0A0H0XSP0 A0A1L9KPB6 Q7MGI1 Q8DDG7
gi|37681434|ref|NP_936043.1| WP_011079056.1.100126 WP_011079056.1.13374 WP_011079056.1.16238 WP_011079056.1.17874 WP_011079056.1.21633 WP_011079056.1.22486 WP_011079056.1.22778 WP_011079056.1.24453 WP_011079056.1.25536 WP_011079056.1.28215 WP_011079056.1.28571 WP_011079056.1.30871 WP_011079056.1.31968 WP_011079056.1.33883 WP_011079056.1.34622 WP_011079056.1.39407 WP_011079056.1.39524 WP_011079056.1.43691 WP_011079056.1.47396 WP_011079056.1.49981 WP_011079056.1.512 WP_011079056.1.53345 WP_011079056.1.53782 WP_011079056.1.54486 WP_011079056.1.54603 WP_011079056.1.54858 WP_011079056.1.55006 WP_011079056.1.553 WP_011079056.1.58875 WP_011079056.1.58885 WP_011079056.1.59022 WP_011079056.1.59048 WP_011079056.1.59451 WP_011079056.1.60167 WP_011079056.1.60868 WP_011079056.1.61535 WP_011079056.1.63462 WP_011079056.1.63825 WP_011079056.1.65015 WP_011079056.1.66219 WP_011079056.1.66581 WP_011079056.1.67868 WP_011079056.1.73066 WP_011079056.1.73173 WP_011079056.1.78369 WP_011079056.1.78668 WP_011079056.1.79678 WP_011079056.1.81060 WP_011079056.1.81460 WP_011079056.1.81555 WP_011079056.1.82587 WP_011079056.1.8292 WP_011079056.1.8379 WP_011079056.1.84562 WP_011079056.1.86005 WP_011079056.1.86748 WP_011079056.1.89979 WP_011079056.1.90288 WP_011079056.1.93668 WP_011079056.1.94371 WP_011079056.1.95941 WP_011079056.1.96968 WP_011079056.1.9921 WP_011079056.1.99976 196600.VV3250 216895.VV1_1022 gi|27364455|ref|NP_759983.1| gi|320154859|ref|YP_004187238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]