SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681446|ref|NP_936055.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681446|ref|NP_936055.1|
Domain Number 1 Region: 6-66,97-261
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.52e-51
Family GidA-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37681446|ref|NP_936055.1|
Sequence length 632
Comment tRNA uridine 5-carboxymethylaminomethyl modification protein GidA [Vibrio vulnificus YJ016]
Sequence
MLYHETFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQMSCNPAIGGIGKGHLV
KEVDAMGGLMAQAIDHAGIQFRTLNASKGPAVRATRAQADRALYKAYVRDFLENAPNLTL
FQQAVDDLIVEQDQVRGVITQMGLKFHAKAVVLTVGTFLGGKIHIGLQSSSGGRAGDPPS
IALADRLRELPFRVDRLKTGTPPRIDARSVDFSVLEAQHGDNPTPVFSFMGDRTHHPRQI
PCFITHTNEQTHEVIRNNLDRSPMYAGIIEGIGPRYCPSIEDKVMRFADKNSHQIFIEPE
GLTTHELYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIEYDFFDPRDLKQTYETK
FIQGLFFAGQINGTTGYEEAAAQGLMAGLNASLFSQEKEGWSPRRDQAYMGVLIDDLSTM
GTKEPYRMFTSRAEHRLLLREDNADLRLTEKARELGLVDDARWARFNQKIDNMEQERQRL
KSTWMNPASTGIDELNQLLKTPMNREASGEDLLRRPEMTYDQLTSLTAFAPAIDDLEAAE
QVEIQVKYEGYIKRQQDEIEKSLRHEHTKLPADLDYSDVKGLSNEVVLKLNTAKPETLGI
ASRISGITPAAISILLVHLKKIGMLKVGEENA
Download sequence
Identical sequences A0A0H0XTR2 Q7MGG9
196600.VV3262 WP_011151445.1.33883 WP_011151445.1.34622 WP_011151445.1.66581 WP_011151445.1.79678 gi|37681446|ref|NP_936055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]