SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676835|ref|NP_937231.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676835|ref|NP_937231.1|
Domain Number 1 Region: 476-557
Classification Level Classification E-value
Superfamily PKD domain 3.4e-17
Family PKD domain 0.0021
Further Details:      
 
Domain Number 2 Region: 624-734
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000034
Family PKD domain 0.0017
Further Details:      
 
Domain Number 3 Region: 133-168,196-218,278-442
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000685
Family beta-glycanases 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37676835|ref|NP_937231.1|
Sequence length 1217
Comment hypothetical protein VVA1175 [Vibrio vulnificus YJ016]
Sequence
MCIKVKSNIFKFSMASLLIFPINSNATIPEKYVEKYIHVDRAKSNAGFVWTKEPTVIVDN
LSGYQQDLSASLSEYGGFLNTKYEATGYFRVEEINGRWWMIDPEGHLTFMSSVVALRPGL
FDEFSPFRDFDHWAETQFPYLKSIGIYTGGGPVTPEQMVKTEHKMNYTPVRNALTEFTNY
LGLPRPKDLKILPVFHEEHADFIDNDLREYLAKYNGDPRFLGLYVDIEMPFDVEVLKLCL
EESQTHFNYLYAVNWVQEFRGNTEPVTVENITELEKEEFFRHYVDSYYAPVSAAMKKYAP
NHLYLGSRVYQTDLLTNKVFVETYAQHADVLSVNRFGYWSEPTEIMDNMIKWGGKPWLVS
AFYAKGTSFEYHDNIEGAGLVTKTQKDRGHYYQNATLTWMQSKGNVGWTWFEYQDNNHIN
NPKNESVSNKGMFDMWHRPYEELTSSIKQVNRQYLNLVEFFDDAKYANTTKDTVFASFKA
DKTNIEPGDSITFSDSSQGANLDYEWSFPGGSPSTSTDKSPSVTYASEGVYDVTLKVSNE
VESDQETWQGKIIVEDANQAPTIKIYEPTDNIQFYQGHIFTVKSETNDNGGKVDFVEFYI
NGDFVNKRRNPPYNLNNWEVSATGEHTIVAKAVDVNGDVIPSEPVRYIGISSELEAGFSA
IRQDIRLGESVNFANESSHNANRWEWVFEGGTPTTSTSKSPTVTYSTPGDHSVKLTAFSD
DGSEMVVKNNFIRVSNSENELPIVNIISPTNGASYPIGSKVTIEVDATDTDGEIESVTFF
VNNNSIKILNQAPYRLTDFVVEEGLNKIDVVAIDNDNDKTISSITVMGVEMDNLPPTVSI
VEPTNNTEFEEGHVIERILAIAADEDGEIAQVEFFANGQHLATVTQPPYQHNNYTVGVGN
VTLSAVATDDKGATATSEVSITGKPVEANKPPTVWFHRPANGEKFEAGEVIIIRAYAEDK
DGEIDSLEIFINGESVKQTSHGSNRIPEWEVTEGVHTLTAVAIDNQGAKSTEIITIYGVD
SEAPLVPTVEIVVPYDGKEYNLGDIIPKVEATAQSTQEDVTIANVEFFVNGESVRIENHS
PYRYWNHVLDKVGVQEIKAVATDSNGAKSESTIHVVVKDPEAALPPSVEIVVPYDGKEYN
LGDTIKKVEATAQSNQEGVTIVNVEFFVNGESVKVSNLSPYRHWNQVLDKIGEQEIKAVA
TDSNGAKTETTINVIVK
Download sequence
Identical sequences Q7MD61
196600.VVA1175 gi|37676835|ref|NP_937231.1| WP_011152437.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]