SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676978|ref|NP_937374.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676978|ref|NP_937374.1|
Domain Number 1 Region: 798-1037
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.57e-52
Family Multidrug efflux transporter AcrB transmembrane domain 0.0006
Further Details:      
 
Domain Number 2 Region: 294-498
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.44e-42
Family Multidrug efflux transporter AcrB transmembrane domain 0.00031
Further Details:      
 
Domain Number 3 Region: 138-184,271-328
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.88e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.003
Further Details:      
 
Domain Number 4 Region: 46-127
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 9.16e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0047
Further Details:      
 
Domain Number 5 Region: 716-800
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 3.14e-18
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.006
Further Details:      
 
Domain Number 6 Region: 185-269
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 4.97e-17
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37676978|ref|NP_937374.1|
Sequence length 1042
Comment silver efflux pump [Vibrio vulnificus YJ016]
Sequence
MIAAIIRWSLNNRFLVLIATLFLTLGGLYSVKNTPVDALPDLSDVQVIIKTSYPGQAPQV
VEDQVTYPLTTAMLAVPGAETVRGYSFFGDSYVYIIFNDKTDMYWARSRVLEYLSQVAPK
LPANAKPTLGPDATGVGWIYSYVLQDKTGKHDLAQLRSLQDWFLKYELQTVEGVSEVATV
GGMVKQYQVQIDPAKLRAYNLTLQQVNMAIQNGNQETGASVIEVAEAEHMVRTTGYLSSV
EDIQSLPLKVTDKGTPLLLGDIADINIGPQMRRGISEFNGEGEAVGGVIVMRFGENASQV
IDNVKAKLADLQRSLPEGVEIVSTYDRSTLINAAVENLWKKLAEEFIVVAVVCALFLFHI
RSSLVIALSLPVGILSAFIVMHWQGINANIMSLGGIAIAIGAMVDGAIVMIENVHKHIER
TPLTDKNRWQVIGKAAEEVGAPLFFSLLIITLSFVPVFALEGQEGKMFSPLAFTKTYAMA
AAAGLAITLVPVLMGYFIRGNVLPEHKNPVNKGLVSLYRPLLSLSLKYPKSMIVLALGLM
ASAYYPTSKLGSEFIPPLDEGDLMYMPTTYPGISIGKARELLQQTNKLIKTVPEVETVWG
KIGRADTATDPAPLTMIETVIQLKPRDQWREGVTTESLRKEFDDLVQFPGLTNAWVMPIK
TRIDMLATGIKTPIGIKIAGPDLKVIEQIGSQLEPILKGVQGTASVYAERVAGGRYVTID
IKRKAAARYGLSIKDVQQVISTAVGGMNVGETIEGLERYPINVRYPQDYRDSVVKLQNLP
LVTPNGARIALADVADIRYEDGPPMIKTENARPNGWVFVDIDGRDLGSYVQEAQNVVAEQ
LELPAGYSLAWSGQYEYMERAKERLSVVVPITLAIIMLLLYFSFRRVGEVLIIMATLPLA
MVGGLWLMHYLGYNFSIAVGVGFIALAGVAVEIGVIMLVYLNQAWHYKKLHAEENKLSLK
PQDLTDAIREGAGLRVRPVMMTVLTVIIGLIPIMYGEGTGSEVMQRIAAPMIGGMASALL
LTLLVLPAIFKLWKNKELTKTE
Download sequence
Identical sequences Q7MCR8
gi|37676978|ref|NP_937374.1| WP_011152555.1.34622 196600.VVA1318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]