SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678689|ref|NP_933298.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678689|ref|NP_933298.1|
Domain Number 1 Region: 523-662
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 1.7e-39
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00000238
Further Details:      
 
Domain Number 2 Region: 402-488
Classification Level Classification E-value
Superfamily PTS system IIB component-like 4.06e-25
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.0000969
Further Details:      
 
Weak hits

Sequence:  gi|37678689|ref|NP_933298.1|
Domain Number - Region: 224-311
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 0.0337
Family LeuD-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37678689|ref|NP_933298.1|
Sequence length 667
Comment PTS system mannitol-specific transporter subunit IIABC [Vibrio vulnificus YJ016]
Sequence
MANRYYNIHQNIKRGILMISPDAKIKIQNFGRFLSNMVMPNIGAFIAWGFITALFIPTGW
LPNETLAAMVGPMITYLLPLLIGYTGGKLVGGDRGAVVGAITTMGVIVGTDIPMFMGAMM
VGPMGGWAIKRFDNYIDGKVKSGFEMLVNNFSAGIIGMLCAILAFFFIGPFVKVLSGGLA
AGVNFLVSAHLLPLTSVFVEPAKILFLNNAINHGIFSPLGIQQASEAGQSIFFLIEANPG
PGLGILLAYMVFGKGTARQTAGGASIIHFFGGIHEIYFPYILMNPRLILAAIAGGMTGVF
VLTVFNAGIVSPASPGSIFAILLMTQKASILGVLASIASATGVSFAVAALLMKTQTSTEE
EGNEAALEKATSQMKNMKSASKGRANVTNQNKSDVDLATVHSIIVACDAGMGSSAMGASM
LRKKIQDAGLNIHVTNLAINSLPESADIVITHKDLTDRARKHAPNAYHISLTNFLDSEMY
NQLVTKLFAAQQLSAANDDNVVKVSVLAANDDTFEAQPPSVFQIQRENIHLGLKANSKEE
AIRFAGNKLVELGYAEPEYIEAMFEREALVPTYLGESIAVPHGTVEAKDRVKKTGIVICQ
YPSGIQFTDDKDDVAKLVIGIAAKNDEHIQVITTITSALDEPEAIERLTSTDDIEEILDI
LGGKQAA
Download sequence
Identical sequences Q7MP59
196600.VV0505 gi|37678689|ref|NP_933298.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]