SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37678945|ref|NP_933554.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678945|ref|NP_933554.1|
Domain Number 1 Region: 7-70
Classification Level Classification E-value
Superfamily IscX-like 2.09e-27
Family IscX-like 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678945|ref|NP_933554.1|
Sequence length 71
Comment hypothetical protein VV0761 [Vibrio vulnificus YJ016]
Sequence
MFQRKMSMKWTDSRDIAIELCERFPDMDPKTVRFTDLHQWILEIEDFDDEPNHSNEKILE
AVILCWLDEWE
Download sequence
Identical sequences Q7MNF6
196600.VV0761 gi|37678945|ref|NP_933554.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]