SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679206|ref|NP_933815.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679206|ref|NP_933815.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily YjgF-like 8.48e-48
Family YjgF/L-PSP 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679206|ref|NP_933815.1|
Sequence length 127
Comment translation initiation inhibitor [Vibrio vulnificus YJ016]
Sequence
MKEIISTPAAPAAIGPYSQGTIYGEVVYTSGQLPLVPETMQFVEGGIKEQAKQSLDNLKA
VLEASGAGLDSVLKTTCFLSDMENFAAFNEVYTEVFGTENAPARSCVEAARLPKDALVEI
EAIAYKK
Download sequence
Identical sequences A0A0H0Y1J0 A0A1L9L773 A0A1V8MZ94 Q7MMP5
gi|37679206|ref|NP_933815.1| gi|27363650|ref|NP_759178.1| gi|320157051|ref|YP_004189430.1| 196600.VV1022 216895.VV1_0167 WP_011078284.1.16238 WP_011078284.1.17874 WP_011078284.1.21633 WP_011078284.1.22486 WP_011078284.1.22778 WP_011078284.1.25536 WP_011078284.1.33883 WP_011078284.1.34622 WP_011078284.1.39524 WP_011078284.1.53345 WP_011078284.1.54486 WP_011078284.1.55006 WP_011078284.1.58885 WP_011078284.1.66581 WP_011078284.1.73066 WP_011078284.1.73173 WP_011078284.1.79678 WP_011078284.1.81060 WP_011078284.1.81460 WP_011078284.1.82587 WP_011078284.1.8379 WP_011078284.1.90288 WP_011078284.1.93668 WP_011078284.1.94371 WP_011078284.1.9921 WP_011078284.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]