SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679587|ref|NP_934196.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679587|ref|NP_934196.1|
Domain Number 1 Region: 2-197
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.5e-44
Family Pseudouridine synthase RsuA/RluD 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679587|ref|NP_934196.1|
Sequence length 231
Comment pseudouridylate synthase, 23S RNA-specific [Vibrio vulnificus YJ016]
Sequence
MFDILFTHPDFLIINKYPHVSVHKDDGDTMLLQEVAKVSGDEQLYLIHRLDKMTSGILLL
GRNSTAASALSQRFAQREVEKFYLAIGAKKPKKKQGTVIGDMERSRRASWKLVNSKQNPA
ITQFFSLAGEPGERAFLCKPYTGKTHQIRVALKSVGSSIIGDPIYNAGSDSDRGYLHAFC
LGFQYQGEQYHFVCDPRNQPALGEKWNSEALNQAIEQWLTPWQLNWPTINK
Download sequence
Identical sequences Q7MLM4
gi|37679587|ref|NP_934196.1| WP_011150063.1.16238 WP_011150063.1.34622 WP_011150063.1.93668 196600.VV1403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]