SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679749|ref|NP_934358.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679749|ref|NP_934358.1|
Domain Number 1 Region: 4-127
Classification Level Classification E-value
Superfamily YjgF-like 1.57e-25
Family YjgF/L-PSP 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679749|ref|NP_934358.1|
Sequence length 140
Comment translation initiation inhibitor [Vibrio vulnificus YJ016]
Sequence
MTRIVKVKTGSKLEEIASYSRVVAVDNWIFVSNTAGRNPETGEMPKDVFEQTEQVFTNIE
VALASVDASLKDVITSKVFIQNPDNVPAVMEFVGTKFRGVNPTTTVTCPPLGSTIYEVEI
EVTAYRGASQADVEEIVLSR
Download sequence
Identical sequences A0A2J7WML8 Q7ML62
WP_011150186.1.34622 196600.VV1565 gi|37679749|ref|NP_934358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]