SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681068|ref|NP_935677.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681068|ref|NP_935677.1|
Domain Number 1 Region: 3-223
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.02e-74
Family Mismatch glycosylase 0.000000457
Further Details:      
 
Domain Number 2 Region: 218-345
Classification Level Classification E-value
Superfamily Nudix 2.84e-26
Family MutY C-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37681068|ref|NP_935677.1|
Sequence length 350
Comment A/G-specific adenine glycosylase [Vibrio vulnificus YJ016]
Sequence
MTPFASAILKWYDAYGRKNLPWQHNKSAYSVWLSEIMLQQTQVATVIPYYQRFLQRFPTV
VDLANAEQDEVLHLWTGLGYYARARNLHKAAKMVAEQYHGEFPLELEQMNALPGIGRSTA
AAVLSSVHKQPHAILDGNVKRTLSRAFAVEGWPGQKTVENQLWQLAEAHTPNTDVDKYNQ
AMMDMGAMVCTRSKPKCTLCPVAELCQANKQGNPLDYPGKKPKKEKPVKETWFAMLHYNN
QVWLEQRPQSGIWGGLFCFPQNEHAQLEALFEKRGIKEGDIRTQNTLIAFRHTFSHYHLD
ITPILLDLSKQPDMVMEASNGLWYNLANPEEVGLAAPVKQLLESLPHELR
Download sequence
Identical sequences Q7MHI5
WP_011151204.1.34622 gi|37681068|ref|NP_935677.1| 196600.VV2884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]