SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37681315|ref|NP_935924.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37681315|ref|NP_935924.1|
Domain Number 1 Region: 151-283
Classification Level Classification E-value
Superfamily CBS-domain pair 2.1e-17
Family CBS-domain pair 0.0027
Further Details:      
 
Domain Number 2 Region: 15-135
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.06e-16
Family cAMP-binding domain 0.019
Further Details:      
 
Weak hits

Sequence:  gi|37681315|ref|NP_935924.1|
Domain Number - Region: 507-607
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.00557
Family Glutamine synthase adenylyltransferase GlnE, domain 2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37681315|ref|NP_935924.1|
Sequence length 615
Comment signal-transduction protein [Vibrio vulnificus YJ016]
Sequence
MLVLDAAMPDKFNMQSPPFDRLSEGQQHLLRSSLDVAYFRTKDVVLAAGQPSPHLHILIK
GAVEERSANQQEVFAHYANDDMFDVRALFEPTVRHQYVALEDTLSYLLPKAIFLELYNEN
GQFAAYFDNNLAKRQELIEAAQQQQNLAEFILTKVDKAIYHPPKILSPEMPINQVTRTLK
ENGIDAALVRLHDDDGRLLNHPNAHPYAIVTRTNMLHSVMLDDKPLDTPVGDIATFPVFH
VDDGDFLFNAMITMTRNRMKRLMVCDGHQAVGMLDMTQILSAFSTHSHVLTLSIARASSV
EELALASNRQRQLVESLLKNGIRTRFIMELISAVNEQIIEKAFELVVPPALHDHCCLIVL
GSEGRGEQILKTDQDNALIIKDGLEWQQSGVVMQQLTHTLQQLGYPLCPGNVMVNNPKWV
KSQSDWRKTLTAWVRSAKPETVMDLAIFADAHAVAGNKALLEPVKQHLSELMADQELILT
EFTRPALNFSVPLTLFGNVKADKSGLDIKQGGIFPIVHGIRALSLEYALHDNNTFDRIEG
LVARNVLEKSTAANLSEALKLFFKLRLAQQLTEQHSNNKLNLKLLDRTERDLLRHSLHVV
KKFKQWLGYHYQIKD
Download sequence
Identical sequences Q7MGU5
196600.VV3131 gi|37681315|ref|NP_935924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]