SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for VDAG_06486T0 from Verticillium dahliae VdLs.17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDAG_06486T0
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.05e-32
Family Nip7p homolog, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 97-172
Classification Level Classification E-value
Superfamily PUA domain-like 2.49e-21
Family PUA domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) VDAG_06486T0
Sequence length 185
Comment | VDAG_06486 | Verticillium dahliae VdLs.17 60S ribosome subunit biogenesis protein NIP7 (186 aa)
Sequence
MRPLVEEETKKVFAKLANYTGGSLKQLIQPLDNGDRYVLRLQKDRVYYVLLSIANLAVSI
ERAKLLSIGTCLGKFTKKGSFKLHITALPILAEHARYKLWVKPNGEMPLLYGSHCVKAHV
GRWTDDIPEHAGIVFYNMADVPIAFGVTARSTADAKRLDPTGIVAFRQADCGEYVRDEDT
LFSSG
Download sequence
Identical sequences A0A0G4MKG2 A0A2J8E6I5 C9SVA3 G2X7M8
XP_003001032.1.67963 XP_009657159.1.79873 VDBG_08828T0 VDAG_06486T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]