SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for VDBG_01632T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_01632T0
Domain Number 1 Region: 3-25,101-170
Classification Level Classification E-value
Superfamily Nudix 0.00000000773
Family MutT-like 0.062
Further Details:      
 
Domain Number 2 Region: 4-68
Classification Level Classification E-value
Superfamily Nudix 0.000000921
Family MutT-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) VDBG_01632T0
Sequence length 180
Comment | VDBG_01632 | Verticillium albo-atrum VaMs.102 conserved hypothetical protein (181 aa)
Sequence
MGEESLLACAVRETLEETGVRVTPLAVRCGTRATPGEGALEGQQELQEMHEVQHMQAVQA
AQAMQAMQRRARGAHVDVQAVESDAEGPVRQGLTEGVDHYEAVACCHWADVATGALKMVF
YYAASADESALPEPLVGEDAGLFENVWCEVDEAAKQLAFPTDGMVVNKAVADMRRTGYDI
Download sequence
Identical sequences C9SAU9
VDBG_01632T0 XP_003007444.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]