SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for VDBG_04081T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_04081T0
Domain Number 1 Region: 57-277
Classification Level Classification E-value
Superfamily CutC-like 1.26e-36
Family CutC-like 0.0000857
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) VDBG_04081T0
Sequence length 309
Comment | VDBG_04081 | Verticillium albo-atrum VaMs.102 copper homeostasis protein cutC (310 aa)
Sequence
MSSVNIFCHVLSPSSSIIPEQNSARLVSSTLRQSCLLSRLVLITLRDTITMSPTTSLEIP
VFSPAAALHAQSLGAQRIELNAQGSYLAGGLTPTLDDLRAVSFSLTIPNRVMIRPRGPPA
EGLDFMYSEAEFEAMLTDVKRLLAGGGLKAERGDGFVFGVLKRGAHGVEADRERNSKLVE
AAGGLVCTFHRAFDELVAGLEGVGLDEKEAKVEQAIRSVAACGFDAILTSGGPGRAPANI
EILRVVTRKAQGRLTIIIGGGVRSGNIGSVLGHLDVDPQSVWAHSSCLVAGEVENIDPVE
ASRMLLQFK
Download sequence
Identical sequences C9SFI6
VDBG_04081T0 XP_003006128.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]