SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for VDBG_04552T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_04552T0
Domain Number 1 Region: 88-241
Classification Level Classification E-value
Superfamily Nudix 1.35e-17
Family MutT-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) VDBG_04552T0
Sequence length 331
Comment | VDBG_04552 | Verticillium albo-atrum VaMs.102 NUDIX domain-containing protein (332 aa)
Sequence
MSTEPLAASSDSSVLHEAAIPPHGIPLGPTALPKPTEEDLSNFVTYLRKASASRPEADTG
SNLDHDLDSSYWDAAAMSPLTAQSAAALARLRAYRPPPLPTWDRLPASRRAAVLLLLFAD
RRGDLRVVITMRAASLRSYSGHAAFPGGKADDVHETPYQIARREAFEEIGLPNIHHPLPA
PFRIESLCELPCNIAQTQIVVRPCVAFLHTDQTTETRPPGAADAHADAPPPAEAMIPVLD
AKEVAAVFSAPFHNFLRAQDEATGRTHPPGHWYDGRWVNFGESPWRVHNFYVPVDAQRVS
KPEVQPEVPPAAARAQDEKQQEEISHGGRNL
Download sequence
Identical sequences C9SHM0
VDBG_04552T0 XP_003004946.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]