SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for VDBG_06009T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_06009T0
Domain Number 1 Region: 567-595,636-670
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000844
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) VDBG_06009T0
Sequence length 832
Comment | VDBG_06009 | Verticillium albo-atrum VaMs.102 sulfate permease (833 aa)
Sequence
MTSTRTKIGHGLAKVLGIKLQENEPQEEMLRGESVISTQSFVEEQPTSAEWLAELVPDAE
FCRKYVKSLFPFINWIGYYNVGWLIGDLVAGITVGAVVVPQGMAYALLANLDPEFGLYSS
FMGVLIYWFFATSKDITIGPVAVLSTVVGNIISRTRDEFPQYAPHEIASALAIISGAIVL
FIGLIRMGWIVNVISLTSLSAFMTGSAISIAVGQTPTMMGIKGFSTREATYKVFINTLKG
LGRTKMDAAMGLSALTMLYVIRSACSYAAKRWPARQRLFFFLSTLRTAFVILLYTMISWL
VNMNRRKHPLFKILGNVPRGFQDVGVPRMDQGLISAFASELPATVIVLVIEHIAISKSFG
RVNNYQIDPSQEFVAIGVTNIFAPFLGGFPSTGSFSRTAIKSKAGVKTPFAGVITGLVVL
LAIYALTAVFFYIPSASLSAVIIHAVGDLITPPNTVYGFWRVSPLECIIFFIGVFVTIFS
SIENGIYATVAISAAMLFWRILRGRGRILGKVKIHSVIGDHVIGEDHRQIVGEYGTFDPQ
DNAARNVFLPVDHGDGSNPEVELDNPYPGIFIYRFSEGFNYPNAAHSLEYLADYIFARTR
RTNLETFDKLADRPWNDPGPSRKATKAAAQRQAVEGRPTLKAVILDFSSVNNVDITSVQQ
LIDVRNQLDRYASPDVVDWHIACINNRWTKRALAAAGFGYPTESHSGMQHRWRSIFSVAE
IGGSDSAAAVAEKQANQREFASQLSRAADEEAALKLAEDDDEPRKASGSADRRTNVHVGA
KRRGVVVHGLNRPLFHVDLTSAMQSAIANVEAREEHVQAQIQDKVQDSSTTQ
Download sequence
Identical sequences C9SM85
VDBG_06009T0 XP_003003567.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]