SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for VDBG_06994T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_06994T0
Domain Number 1 Region: 5-95
Classification Level Classification E-value
Superfamily Dcp2 domain-like 1.96e-36
Family Dcp2 box A domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 87-140
Classification Level Classification E-value
Superfamily Nudix 0.000000437
Family mRNA decapping enzyme-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) VDBG_06994T0
Sequence length 169
Comment | VDBG_06994 | Verticillium albo-atrum VaMs.102 mRNA-decapping enzyme (170 aa)
Sequence
MAAYKMQLEDWLDDLCVRFIINLPEEDLSSVARICFQIEEAQWFYEDFVRPLDPTLPSMT
LRNFSLRIFQHCPLLAPFSVENHTRAFEEFLQYKTRVPVRGAILLNEDMDSTVLVKGWKK
GANWSFPRGKINKDEDDWNAPSERSMKKRDTISMLPAWFLLIGMLSISR
Download sequence
Identical sequences C9SR82
XP_003002423.1.67963 VDBG_06994T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]