SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for VDBG_09631T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_09631T0
Domain Number 1 Region: 137-300
Classification Level Classification E-value
Superfamily Nudix 0.00000000195
Family IPP isomerase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) VDBG_09631T0
Sequence length 352
Comment | VDBG_09631 | Verticillium albo-atrum VaMs.102 conserved hypothetical protein (353 aa)
Sequence
MIINPYQVNAETIPKGTWAFCLTSKRYDTEGRPHSKLIRFGYILANVATHLQRLCDQPRG
GNGRRQLLKFENSNVIPLDESSSKALEDTFKEVCARLHGDPQARGLWGKDGPEMQETTPV
IGAPIPFNMIYGVVPLFGIVTSGAHLNAFHGDGENMIIWLAQRGASKSSYPNCFDQIVAG
GNDGRQDQTPLDIILREAKEEVKDDQLHQTLIKAKGPDTIITYHVFNPTAPGTAATIAAG
KIEPGIRYVFDYEVHDPNYVFKKNEDDIAHITSYTVTQVKDMLRQGQFKPNCGLVMFNFL
VRKGRIGDDDPLYQETERGLEFPFIWKEGITCDEESYSSFQRQERRHDTAYE
Download sequence
Identical sequences C9SWY0
XP_003000436.1.67963 VDBG_09631T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]