SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for VDBG_09950T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_09950T0
Domain Number 1 Region: 18-95,141-221
Classification Level Classification E-value
Superfamily Nudix 0.000000000765
Family MutT-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) VDBG_09950T0
Sequence length 363
Comment | VDBG_09950 | Verticillium albo-atrum VaMs.102 conserved hypothetical protein (364 aa)
Sequence
MSQTRAASSSSKEKKPAVAPRPSSSILLLSPTNQVLLLHRVKTSSSFASAHVFPGGNLDA
FHDGDIPAEHAEERHVDGPAYRIGAIRECFEETGILLARRKGAKSDAALVSLPNGNREAA
RKQIHGNHVRFSDWAESVGGTPDVEGLIPFTRWVTPTNVPKRFTTQMYLYLLPDTAAFDR
VEAAQQEEIIVPTPDGGVEHTAARFDDAATWLAKADAGEIILFPPQYYLLHHVARFCTQQ
GSGTSFSVFESQRQKLLQFLRKTPTASSEKGIAHPTSSIPWSEKVMSPQNLLIRSSDKRI
VLGLDKPGPELKDSGRGGDWERVVLVKFSKEGPRKVEIRDREEILAEEREEKSGEGSGAR
HKL
Download sequence
Identical sequences C9SYH5
VDBG_09950T0 XP_002999910.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]