SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|172087701|ref|YP_204741.2| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172087701|ref|YP_204741.2|
Domain Number 1 Region: 121-328
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.9e-43
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|172087701|ref|YP_204741.2|
Sequence length 340
Comment formate dehydrogenase N subunit gamma [Vibrio fischeri ES114]
Sequence
MLKQLKRLSLSLLLPLMAALTLSFAMPSMANESAAAKSAEKEMTQLAGADIWREVRAGQE
GYTTSQWPEHGVLISTAGETWFVLKEKWMSPLGALAIFGSLVMVTLAYFVVGPLKLSKPK
TGRKIKRWSRMDRALHWSMAFSFLTLAFSGLCLVYGKHFLKPILPSEIWGMIIYAAKQYH
NYMGPIFFILLMCVLLKWWRKSIFNKTDIQWFMKMGGMVGKHKGSHPSAGFSNGGEKAIY
WLLIVFGIVVAFSGFVLDFPMFGQLRRDMELSNLVHMLSALILICGFIFHIYIGLFGMEA
GLDGMVTGDVDETWAKEHHDLWYHEVKDLPENQPQDKKVD
Download sequence
Identical sequences A0A1B9PBU1 B5FE93 Q5E543
WP_005419328.1.102040 WP_005419328.1.198 WP_005419328.1.21686 WP_005419328.1.21775 WP_005419328.1.21836 WP_005419328.1.31530 WP_005419328.1.32349 WP_005419328.1.34024 WP_005419328.1.3463 WP_005419328.1.44395 WP_005419328.1.47877 WP_005419328.1.62330 WP_005419328.1.66091 WP_005419328.1.76599 WP_005419328.1.76652 WP_005419328.1.77059 WP_005419328.1.82276 WP_005419328.1.85856 WP_005419328.1.93430 WP_005419328.1.94618 WP_005419328.1.97281 YP_204741.2.56684 gi|172087701|ref|YP_204741.2| gi|197334650|ref|YP_002156158.1| 312309.VF_1358 388396.VFMJ11_1439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]