SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|172087773|ref|YP_205797.2| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172087773|ref|YP_205797.2|
Domain Number 1 Region: 5-239,349-705,761-937,1045-1129,1183-1341
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 0
Family RNA-polymerase beta 0.0000000000000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|172087773|ref|YP_205797.2|
Sequence length 1342
Comment DNA-directed RNA polymerase subunit beta [Vibrio fischeri ES114]
Sequence
MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFTKFIEQDPEGQYGLEAAFRSVFPIQ
SYNGNSKLEYVSYNLREPEFDVKECQIRGVTYSAPLRVKLRLVVYDKDAPANTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARVIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNKTTEEILDLFFDKVVFEVKDQTLMME
LIPERLRGETATFDIEANGKVYVEAGRRITARHIRQLTKDDITHIEVPVDYIVGKVASHD
YVNEDTGEIIIAANQEFSLEDLANLSQAGYKKIEVLFTNDLDHGAYISDTLRADSTVDRL
SALVEIYRMMRPGEPPTKEAAEALFESLFFSEERYDLSTVGRMKFNSSIGRDNDEGAGVL
DETDIIEVMRKLIDIRNGIGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVRERLS
LGDLDAIMPQDLINAKPISAAVKEFFGSSQLSQFMDQNNPLSEVTHKRRISALGPGGLTR
ERAGFEVRDVHATHYGRLCPIETPEGPNIGLINSLSAFAQCNEYGFLETPYRRVVDGQVT
DQVDYLSAIEEGTFVIAQANAVLTEEGTFADELIIARQKGESGLHPREHIQYMDVATNQV
VSVAASLIPFLEHDDANRALMGANMQRQAVPTLKADKPLVGTGIERNVAVDSGVTAVAKR
GGVVQSVDASRIVIKVNEDELVPGEAGIDIYNLTKYTRSNQNTCINQRPTVLPGEPVTRG
DVLADGPSTDLGELALGQNMRIAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELSCVA
RDTKLGSEEITADIPNVGEAALSKLDESGIVYIGAEVKGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNSVSGTIIDVQVFTRDGVEKDKRALEIEQMQLKEAKKDI
TEEFQILEGGLLARVRTLLVAAGVSEVKLDAMDRKQWLEITLDDEAQQNQLEQLAEQYDE
LKAEFDKKFETKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PVEDMPYDEKGQPVDIVLNPLGVPSRMNIGQILEVHMGLAAKGVGDKINQMLKEQQELHK
FRNFLQKVYDLGETRQEVDIAALSDDEVRTLIKNLRGGLPIATPIFDGAPEASIKELLKL
VDLPESGQLKLFDGRTGDAFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGG
KAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEPGMPE
SFNVLLKEIRSLGINIELEDEE
Download sequence
Identical sequences Q5E238
gi|172087773|ref|YP_205797.2| WP_011262791.1.100783 WP_011262791.1.11820 WP_011262791.1.21775 WP_011262791.1.21836 WP_011262791.1.23113 WP_011262791.1.34959 WP_011262791.1.76652 WP_011262791.1.80135 YP_205797.2.56684 312309.VF_2414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]