SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|59710668|ref|YP_203444.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59710668|ref|YP_203444.1|
Domain Number 1 Region: 3-86
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.41e-27
Family 2Fe-2S ferredoxin-related 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59710668|ref|YP_203444.1|
Sequence length 87
Comment phenol hydroxylase P5 protein [Vibrio fischeri ES114]
Sequence
MKKITLLPQQKEFSIEEGQTILDAALEAGINYPNRCQVGACAMCLCKKLEGEIEYDLEPL
LTDKEQQEGWVFACQATAKSDLVLLLE
Download sequence
Identical sequences A0A1B9PAK3 B5FF92 Q5E8U0
gi|197334089|ref|YP_002154830.1| 312309.VF_0061 388396.VFMJ11_0059 WP_005416876.1.11820 WP_005416876.1.198 WP_005416876.1.21686 WP_005416876.1.21775 WP_005416876.1.21836 WP_005416876.1.23113 WP_005416876.1.31530 WP_005416876.1.34024 WP_005416876.1.3463 WP_005416876.1.34959 WP_005416876.1.44395 WP_005416876.1.47877 WP_005416876.1.62330 WP_005416876.1.76652 WP_005416876.1.80135 WP_005416876.1.85856 WP_005416876.1.93430 WP_005416876.1.97281 YP_203444.1.56684 gi|59710668|ref|YP_203444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]