SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59710706|ref|YP_203482.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59710706|ref|YP_203482.1|
Domain Number 1 Region: 5-211
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.42e-59
Family G proteins 0.00011
Further Details:      
 
Domain Number 2 Region: 155-303
Classification Level Classification E-value
Superfamily Translation proteins 2.02e-32
Family Elongation factors 0.0045
Further Details:      
 
Domain Number 3 Region: 403-517
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.75e-27
Family EF-G/eEF-2 domains III and V 0.0055
Further Details:      
 
Domain Number 4 Region: 306-391
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.31e-16
Family EF-G/eEF-2 domains III and V 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59710706|ref|YP_203482.1|
Sequence length 610
Comment GTP-binding protein [Vibrio fischeri ES114]
Sequence
MSTPQIDKLRNIAIIAHVDHGKTTLVDKLLQQSGTLESRGETEERVMDSNDIEKERGITI
LAKNTAINWNDHRINIVDTPGHADFGGEVERIMSMVDSVLLIVDAVDGPMPQTRFVTQKA
FAHGLKPIVVINKIDRPGARPDWVMDQVFDLFDNLGATDEQLDFQVVYASALNGWATLEE
GETGENMEPLFQAIVDNVDAPNVDVDGALQMQVSQLDYNSYVGVIGVARVTRGSVKPNQQ
VTVVSADGSKRNGKVGTVLGYLGLERHEVEQANAGDIIAITGLGELKISDTICDVNNVEA
MTPLSVDEPTVTMTFQVNTSPFAGKEGKFVTSRNILERLEKELVHNVALRVEQTEDPDKF
RVSGRGELHLSILIENMRREGFELAVSRPEVIIKKDENGNLTEPFETVTIDVLEEHQGGI
MENIGIRKGELTDMAPDGKGRVRMDFMMPSRGLIGFQTEFMTLTSGSGLLYHTFDHYGPH
KGGTIGQRNNGVLISNATGKALTYALFNLQERGRLFTEHADEVYEGQVIGIHNRSNDLTV
NCLKGKQLTNVRASGTDDAQVLSPAIKYTLEQALEFIDDDELVEVTPESIRIRKRHLTEN
DRKRAGRAPK
Download sequence
Identical sequences Q5E8Q2
gi|59710706|ref|YP_203482.1| 312309.VF_0099 WP_005416970.1.100783 WP_005416970.1.102040 WP_005416970.1.11820 WP_005416970.1.21775 WP_005416970.1.21836 WP_005416970.1.23113 WP_005416970.1.34959 WP_005416970.1.62330 WP_005416970.1.66091 WP_005416970.1.76599 WP_005416970.1.76652 WP_005416970.1.77059 WP_005416970.1.80135 WP_005416970.1.82276 WP_005416970.1.94618 YP_203482.1.56684 VfR196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]