SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|59710865|ref|YP_203641.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59710865|ref|YP_203641.1|
Domain Number 1 Region: 1-37
Classification Level Classification E-value
Superfamily Ribosomal protein L36 2.09e-16
Family Ribosomal protein L36 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59710865|ref|YP_203641.1|
Sequence length 37
Comment 50S ribosomal protein L36 [Vibrio fischeri ES114]
Sequence
MKVRASVKKICRNCKVIKRNGVVRVICVEPKHKQRQG
Download sequence
Identical sequences A0A1B9PAY7 B5FGD7 Q5E893
312309.VF_0258 388396.VFMJ11_0246 gi|59710865|ref|YP_203641.1| WP_005417265.1.100783 WP_005417265.1.102040 WP_005417265.1.11820 WP_005417265.1.198 WP_005417265.1.21686 WP_005417265.1.21775 WP_005417265.1.21836 WP_005417265.1.23113 WP_005417265.1.31530 WP_005417265.1.32349 WP_005417265.1.34024 WP_005417265.1.3463 WP_005417265.1.34959 WP_005417265.1.37085 WP_005417265.1.44395 WP_005417265.1.47877 WP_005417265.1.48562 WP_005417265.1.62330 WP_005417265.1.66091 WP_005417265.1.76599 WP_005417265.1.76652 WP_005417265.1.77059 WP_005417265.1.80135 WP_005417265.1.81434 WP_005417265.1.82276 WP_005417265.1.85856 WP_005417265.1.93430 WP_005417265.1.94618 WP_005417265.1.97281 YP_203641.1.56684 gi|197334054|ref|YP_002155017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]