SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59710872|ref|YP_203648.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59710872|ref|YP_203648.1|
Domain Number 1 Region: 97-308
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 4.45e-52
Family MurCDEF 0.00061
Further Details:      
 
Domain Number 2 Region: 311-446
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 4.19e-39
Family MurCDEF C-terminal domain 0.0059
Further Details:      
 
Domain Number 3 Region: 1-89
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 9.42e-23
Family MurCD N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59710872|ref|YP_203648.1|
Sequence length 459
Comment UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [Vibrio fischeri ES114]
Sequence
MHIHILGICGTFMGGAATLARQLGHKVTGCDANVYPPMSTLLESQGIEIIEGFDPSQLDP
APDLVVIGNAMSRGNPCVEYVLDKNLKYTSGPQWLQEFLLQDRWVMAVAGTHGKTTTSSM
LAWVLEECGYKPGFLVGGVLGNFGESARLGESMFFVVEADEYDSAFFDKRSKFVHYRPRT
LVLNNLEFDHADIFDDLAAIQRQFHHLIRTVPSTGRIFAPKQDKPLEQVLEQGCWSELEF
TGEDGQWKAIKLQKDGSQFDVYFEGENVGQVNWDLVGDHNVSNALMVVASARHVGVTPDL
ACEALGKFINTKRRLELKGEVNGVTVYDDFAHHPTAIDLTLNGLRNKVGDKKIIAVLEPR
SSTMKLGVHKDTLAASLHAADSVYLYQPDNIAWSVDDVAQQCTQPAHTHNNIDAFVDMIV
NEAQPGDQILVMSNGGFEGIHGKLLSGLGDAVKHIEMVD
Download sequence
Identical sequences Q5E886
gi|59710872|ref|YP_203648.1| 312309.VF_0265 WP_011261084.1.76652 YP_203648.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]