SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59710928|ref|YP_203704.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59710928|ref|YP_203704.1|
Domain Number 1 Region: 19-237
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-59
Family G proteins 0.0000000939
Further Details:      
 
Domain Number 2 Region: 333-435
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.16e-29
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 243-328
Classification Level Classification E-value
Superfamily Translation proteins 2.08e-24
Family Elongation factors 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59710928|ref|YP_203704.1|
Sequence length 478
Comment sulfate adenylyltransferase subunit 1 [Vibrio fischeri ES114]
Sequence
MNSAVEQQLAELGIEAYLKEHQYKSLLRFLTCGSVDDGKSTLIGRLLHDSKQIYADQLDA
VHADSQRVGTTGERPDLALLVDGLQAEREQGITIDVAYRYFSTQKRKFIIADTPGHEQYT
RNMATGASTCNVAVILIDARKGVLDQTRRHSYIANLLGIRHFVVAVNKMDLVEYSQSRFE
EIKEEYLAFSKKLNNPNLDISILPLSALEGDNVVNPSDALSWYQGEPLLEVLENVDIDAD
KGNGEFRFPVQYVNRPNLDFRGFAGTVSSGGISVGDEIVALPSGKKSKVARIVTFDGDLT
SAQAGQAVTLTLEDEIDISRGDLLVKSQSNLQATDQFKAEIVWMTEKGLEPGRQYDIKIA
GKKTVGQIDAIHHQVNINSLEKFDTQELPLNGIGLCDVSLTETVSLDRYQDCADTGGFIF
IDRLTNVTVGAGMIQNLSDLSESKPINDNISAFEIELNALIRKHFPHWETKDISKLLG
Download sequence
Identical sequences Q5E830
312309.VF_0321 gi|59710928|ref|YP_203704.1| WP_011261125.1.76652 YP_203704.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]