SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711016|ref|YP_203792.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711016|ref|YP_203792.1|
Domain Number 1 Region: 8-128
Classification Level Classification E-value
Superfamily Hypothetical protein VC0424 1.01e-36
Family Hypothetical protein VC0424 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59711016|ref|YP_203792.1|
Sequence length 138
Comment hypothetical protein VF_0409 [Vibrio fischeri ES114]
Sequence
MSQEDEYLSVEQFLELQKAETREIIESLKADGSEPDALYAIEHHLMAEDFKALENAVVEA
FKMGFEVLEAEELEDEDGAKILCCDAVMDSALDAEVIDAQVEKLVNLAEKYDIIYDGWGT
YYEGEDAEYDVIEDGDED
Download sequence
Identical sequences A0A1B9P5K5 B5F9Q2 Q5E7U2
gi|197335035|ref|YP_002155165.1| WP_005417527.1.100783 WP_005417527.1.102040 WP_005417527.1.11820 WP_005417527.1.198 WP_005417527.1.21686 WP_005417527.1.21775 WP_005417527.1.21836 WP_005417527.1.23113 WP_005417527.1.31530 WP_005417527.1.32349 WP_005417527.1.34024 WP_005417527.1.3463 WP_005417527.1.34959 WP_005417527.1.44395 WP_005417527.1.47877 WP_005417527.1.62330 WP_005417527.1.66091 WP_005417527.1.76599 WP_005417527.1.76652 WP_005417527.1.77059 WP_005417527.1.80135 WP_005417527.1.81434 WP_005417527.1.82276 WP_005417527.1.85856 WP_005417527.1.93430 WP_005417527.1.94618 WP_005417527.1.97281 YP_203792.1.56684 gi|59711016|ref|YP_203792.1| 312309.VF_0409 388396.VFMJ11_0399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]