SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711044|ref|YP_203820.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711044|ref|YP_203820.1|
Domain Number 1 Region: 23-232
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 9.3e-93
Family Endonuclease I 0.0000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59711044|ref|YP_203820.1|
Sequence length 234
Comment DNA-specific endonuclease I [Vibrio fischeri ES114]
Sequence
MKLIRLLISIIAIGSAFNVLAAPPSSFSKAKKEAVKIYLDHPTSFYCGCDITWKDKKKGI
PDLQSCGYNVRKQEKRASRIEWEHVVPAWQFGHQRQCWQDGGRKNCTRKDKQFKLMEADL
HNLVPAIGEVNGDRSNFRFSQWNGNKGAYYGQCAFKVDFKGRVAEPPAQSRGAIARTYLY
MNQEYRFNLSKSQRQLMNAWDKQYPVSEWECERDKRIAKIQGNHNQFVYKACRK
Download sequence
Identical sequences A0A1B9PIE3 B5F9T0 Q5E7R4
gi|59711044|ref|YP_203820.1| WP_011261220.1.100783 WP_011261220.1.102040 WP_011261220.1.198 WP_011261220.1.31530 WP_011261220.1.34024 WP_011261220.1.44395 WP_011261220.1.66091 WP_011261220.1.76652 WP_011261220.1.77059 WP_011261220.1.82276 WP_011261220.1.93430 WP_011261220.1.94618 YP_203820.1.56684 gi|197335086|ref|YP_002155193.1| 312309.VF_0437 388396.VFMJ11_0437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]