SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711091|ref|YP_203867.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711091|ref|YP_203867.1|
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily YhbC-like, N-terminal domain 3.27e-25
Family YhbC-like, N-terminal domain 0.00084
Further Details:      
 
Domain Number 2 Region: 84-151
Classification Level Classification E-value
Superfamily YhbC-like, C-terminal domain 5.1e-17
Family YhbC-like, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59711091|ref|YP_203867.1|
Sequence length 151
Comment hypothetical protein VF_0484 [Vibrio fischeri ES114]
Sequence
MTGLERQLTEMLEAPVGALGYELVGLEFVRAGEHSTLRVFIDHENGIFVEDCAEASRQIS
AVMDVEDPITVAYNLEVSSPGLERPLFKAAHYQQFVGHEVSLVLKMPMNNRRKWKGDILE
INGEIVTVTVDGNNEEFALSNISKANLVPKF
Download sequence
Identical sequences Q5E7L7
gi|59711091|ref|YP_203867.1| 312309.VF_0484 WP_011261256.1.100783 WP_011261256.1.102040 WP_011261256.1.11820 WP_011261256.1.21775 WP_011261256.1.21836 WP_011261256.1.23113 WP_011261256.1.34959 WP_011261256.1.66091 WP_011261256.1.76652 WP_011261256.1.77059 WP_011261256.1.80135 WP_011261256.1.82276 WP_011261256.1.94618 YP_203867.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]