SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711107|ref|YP_203883.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711107|ref|YP_203883.1|
Domain Number 1 Region: 7-274
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-84
Family G proteins 0.0000847
Further Details:      
 
Domain Number 2 Region: 259-390
Classification Level Classification E-value
Superfamily Translation proteins 5.18e-28
Family Elongation factors 0.0063
Further Details:      
 
Domain Number 3 Region: 390-465
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.32e-17
Family EF-G/eEF-2 domains III and V 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59711107|ref|YP_203883.1|
Sequence length 526
Comment peptide chain release factor 3 [Vibrio fischeri ES114]
Sequence
MSFLQEVGKRRTFAIISHPDAGKTTITEKVLLFGNAIQKAGTVKGRGSNQHAKSDWMEME
KERGISVTTSVMQFPFNDCLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAKGVEDRT
RKLMEVTRLRDTPIVTFMNKLDREVRDPMEVLDEVESELGMACAPISWPIGCGKEFKGVY
HIHRDETILYESGHGHEIQEVRTIKGLDNPELDATVGADLAESVREELELVMGACPEFDH
ELFLAGELTPVYFGTALGNFGVDHMLEGLTDWAPAPQTRQANERDVVATEDKFSGFVFKI
QANMDPKHRDRIAFMRIVSGTYTQGMKMNHVRTGKNVSISDAVTFMAGDRSRAETAYAGD
IIGLHNHGTIQIGDTFTQGESLKFSGIPNFAPELFRRIRLKDPLKQKQLLKGLVQLSEEG
AVQVFRPLQNNDLIVGAVGVLQFDVVVARLKAEYNVEAIYEGVSVATARWVDCADGKKMD
EFQRKNQANLALDGGDNLTYIAPTMVNLNLASERFPDVQFRATREH
Download sequence
Identical sequences Q5E7K1
gi|59711107|ref|YP_203883.1| 312309.VF_0500 WP_011261269.1.100783 WP_011261269.1.102040 WP_011261269.1.11820 WP_011261269.1.21775 WP_011261269.1.21836 WP_011261269.1.34959 WP_011261269.1.76652 WP_011261269.1.80135 YP_203883.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]