SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711143|ref|YP_203919.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711143|ref|YP_203919.1|
Domain Number 1 Region: 3-253
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.73e-108
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000027
Further Details:      
 
Domain Number 2 Region: 254-463
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 4.32e-60
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00000821
Further Details:      
 
Domain Number 3 Region: 550-710
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.1e-52
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0045
Further Details:      
 
Domain Number 4 Region: 453-550
Classification Level Classification E-value
Superfamily Translation proteins 2.72e-18
Family AlaX-M N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59711143|ref|YP_203919.1|
Sequence length 859
Comment alanyl-tRNA synthetase [Vibrio fischeri ES114]
Sequence
MYMSTDEIRRAFLAFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDCFLGSEKRNYT
RATTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFKQDAIKYAWEFLTERLE
LPADRLLVTVYETDDEAFEIWNKEMGIPADRIVRIGDNKGAPYASDNFWQMGDTGPCGPC
TEIFYDHGEHIWGGRPGTPEEDGDRFIEIWNNVFMQFNRHADGTMEPLPKPSVDTGMGIE
RIAAIMQGVHSNYEIDIFQTLIKEAAKVIGYDDLSNQSLRVVADHIRSCSYLIVDGVMPS
NEGRGYVLRRIIRRAVRHGNKLGAKGSYFYKLVGPLAEIMGTAGEELKKQQALVEKVLKI
EEENFGRTLERGMAILNEALDNLEGTVLDGETVFKLYDTYGFPADLTNDVARERELTIDE
DGFEKAMEEQRQRAREAGQFGTDYNAVIKVESETVFHGYDSTEAKASVVALFREGEEVDA
LSAGDDAILILDQTPFYAESGGQCGDAGIITVETGKFVVTDTHKIGNAIGHHGKLVEGVL
SKADHAMAQVDETRRAAIILNHSATHLLHAALRQVLGEHVTQKGSLVKAENLRFDFSHLE
AVKAEELRQVERIVNQQIRLNHTIETDLMDIDAAKEKGAMALFGEKYDDEVRVLSMGEFS
TELCGGIHASSTGDIGLFKITSEGGIAAGIRRIEAVTGEAALDAIEAQQKAADKKLNEAA
SKAKQLEKEIQQLKDKLASQESASLINKVQEIAGTKVLVAQLDGAENKALRGMVDELKNQ
IGSGIIMLGNVSEGKVGLIAGVTKDLIGQVKAGELVNMVAQQVGGKGGGRPDMAQAGGTD
AEALPNALASVEAWLTERL
Download sequence
Identical sequences Q5E7G5
WP_011261300.1.102040 WP_011261300.1.11820 WP_011261300.1.21775 WP_011261300.1.66091 WP_011261300.1.76652 WP_011261300.1.77059 WP_011261300.1.80135 WP_011261300.1.82276 WP_011261300.1.94618 YP_203919.1.56684 gi|59711143|ref|YP_203919.1| 312309.VF_0536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]