SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711157|ref|YP_203933.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711157|ref|YP_203933.1|
Domain Number 1 Region: 6-93
Classification Level Classification E-value
Superfamily Translation proteins 9.89e-23
Family RimM N-terminal domain-like 0.00073
Further Details:      
 
Domain Number 2 Region: 99-175
Classification Level Classification E-value
Superfamily PRC-barrel domain 3.73e-20
Family RimM C-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59711157|ref|YP_203933.1|
Sequence length 175
Comment 16S rRNA-processing protein RimM [Vibrio fischeri ES114]
Sequence
MSKQDEVIVVGKFGASYGIRGWLKVVSFTDQPESIFDYKPWLIQVKGEWVEFSVESWKRH
KGLVCKLKGLDVREEAQTYTNLEIAVKADALPELSEDEFYWRELFGMEVVTTKGYALGVV
DDIFETGSNDVLVVKANLKDAFGKKERLIPFIDEQVIKLIDREAQRIEVDWDPGF
Download sequence
Identical sequences Q5E7F1
gi|59711157|ref|YP_203933.1| 312309.VF_0550 WP_011261312.1.100783 WP_011261312.1.102040 WP_011261312.1.11820 WP_011261312.1.21836 WP_011261312.1.23113 WP_011261312.1.34959 WP_011261312.1.66091 WP_011261312.1.76652 WP_011261312.1.77059 WP_011261312.1.82276 WP_011261312.1.94618 YP_203933.1.56684 VfR79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]