SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711232|ref|YP_204008.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711232|ref|YP_204008.1|
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 2.75e-59
Family Nucleoside diphosphate kinase, NDK 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59711232|ref|YP_204008.1|
Sequence length 144
Comment nucleoside diphosphate kinase [Vibrio fischeri ES114]
Sequence
MTIERTFSIVKPDAVKRNLIGAIYRRIEKTGMQIVAAKMLRLTKEQAEGFYAEHEGKEFF
DELVAYMMSGPVMVQVLEGENAVVRYRELMGKTNPEEAACGSLRADYAISMRYNSVHGAD
SPESAAREIAYFFAEDEICPRPAE
Download sequence
Identical sequences A0A1B9PLC9 Q5E776
WP_005417926.1.100783 WP_005417926.1.102040 WP_005417926.1.11820 WP_005417926.1.21775 WP_005417926.1.21836 WP_005417926.1.23113 WP_005417926.1.34024 WP_005417926.1.34959 WP_005417926.1.47877 WP_005417926.1.62330 WP_005417926.1.66091 WP_005417926.1.76599 WP_005417926.1.76652 WP_005417926.1.77059 WP_005417926.1.80135 WP_005417926.1.81434 WP_005417926.1.82276 WP_005417926.1.93430 WP_005417926.1.94618 YP_204008.1.56684 312309.VF_0625 gi|59711232|ref|YP_204008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]