SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711257|ref|YP_204033.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711257|ref|YP_204033.1|
Domain Number 1 Region: 10-159
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 9.7e-56
Family Deoxycytidylate deaminase-like 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59711257|ref|YP_204033.1|
Sequence length 171
Comment tRNA-specific adenosine deaminase [Vibrio fischeri ES114]
Sequence
MSVKQESRDASFYMQRAMELAAIAEQEGEVPVGAVIVLDDEIIGEGWNRSISTHDATAHA
EMMAIKQAGSKIENYRLVDATLYVTLEPCPMCAGAIVHSRIKRVIFGASDMKTGASGSVI
NLFTSATAFHFVECESGVMEEACRSQLQAFFKRRRKEKKEEKKARREAEQK
Download sequence
Identical sequences Q5E751
312309.VF_0650 WP_011261380.1.21836 WP_011261380.1.23113 WP_011261380.1.76652 YP_204033.1.56684 gi|59711257|ref|YP_204033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]